Rat Secondary Antibodies
American Research Products Inc Anti IgG2a Biotin
Mouse monoclonal antibody to Rat IgG2a Biotin conjugate
American Research Products Inc Anti CD9 unconjugated
Rat monoclonal antibody to Human CD9 (Leukemia and Platelet Associated Antigen p24)
American Research Products Inc AntiHuman CD49D
Anti-Human CD49D (Integrin alpha 4) (Natalizumab) - APC Biosimilar is a biosimilar antibody with human reactivity Available in 50ug size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
American Research Products Inc AntiHuman CD2 In Vivo Ab
Anti-Human CD2 In Vivo Antibody - Ultra Low Endotoxin is a in vivo antibody with human reactivity produced in mouse Available in 100 mg size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
American Research Products Inc AntiHuman TIGIT
Anti-Human TIGIT [4E1 2] In Vivo Antibody - Low Endotoxin is a in vivo antibody with human reactivity produced in mouse Available in 100 mg size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
FUJIFILM BIOSCIENCES INC Anti Claudin-5 Rat Monoclonal
Claudin-5 is a tetra-transmembrane protein with approximately 23kDa belongs to a member of Claudin family It functions as a key component in blood-brain barrier This product is a rat monoclonal antibody which specifically recognizes Claudin-5 and has neutralizing activity have neutralizing activity which reduces barrier function in blood-brain barrier model Specific to Claudin-5 no cross-reactivity with Claudin-1 467 Validated in BBB model for neutralizing function
Genscript Corporation Human Lambda Light Chain 2D54
Immunoglobulins (Ig) and free light chains (FLC) is involved in humoral immune response Ig is composed of two identical light chains and two identical heavy chains FLC contains two types kappa free light chain (KFLC) and lambda free light chain (LFLC) The expression of Kappa or Lambda is greatly increased in multiple myeloma or other B cell malignancies It is useful for the identification of certain non-Hodgkin s lymphomas leukemias and plasmacytomas Immunohistochemistry is commonly applied for the detection of free light chains
ABclonal Technology APC/Cy7 anti-h/Mk CD19
This gene encodes a cell surface protein in the immunoglobulin superfamily expressed exclusively on B cell lymphocytes It serves as a marker for pre-B cells with expression decreasing as B cells differentiate into antibody-secreting plasma cells The protein contains two N-terminal Ig-like domains a non-Ig-like domain a transmembrane region and a large cytoplasmic domain It forms a complex with CD21 and CD81 lowering the threshold for antigen-triggered B cell activation which activates the PI3K signaling pathway and calcium release This protein is targeted by CAR T-cells for treating lymphoblastic leukemia Mutations are linked to common variable immunodeficiency 3 (CVID3) causing impaired B-cell differentiation hypogammaglobulinemia inability to respond to antigens and recurrent infections Alternative splicing produces multiple transcript variants encoding distinct isoforms
American Research Products Inc AntiHuman CD49D
Anti-Human CD49D (Integrin alpha 4) (Natalizumab) - Dylight 488 Biosimilar is a biosimilar antibody with human reactivity Available in 100ug size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
American Research Products Inc AntiHuman CD307e
Anti-Human CD307e (FcRL5) In Vivo Antibody - Ultra Low Endotoxin is a in vivo antibody with human reactivity produced in mouse Available in 100 mg size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
CPC Scientific H-Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (trifluoroacetate salt) 1MG
ONE-LETTER SEQUENCE: SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Cys23 and 39 bridge)MOLECULAR FORMULA: C213H349N71O65S3MOLECULAR WEIGHT:5040.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [123337-89-3], SYNONYMS: BNP-45 (rat), Brain Natriuretic Peptide-45 (rat)RESEARCH AREA: CardiovascularREFERENCES: M. Aburaya et al., BBRC, 163, 226 (1989)
CPC Scientific H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (trifluoroacetate salt) 1MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Cys10 and 26 bridge)MOLECULAR FORMULA: C146H239N47O44S3MOLECULAR WEIGHT:3453STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [133448-20-1], RESEARCH AREA: CardiovascularREFERENCES: M. Kojima et al., BBRC, 159, 1420 (1989)
ABclonal Technology APC anti-Human CD90/Thy1
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins The encoded protein is involved in cell adhesion and cell communication in numerous cell types but particularly in cells of the immune and nervous systems The encoded protein is widely used as a marker for hematopoietic stem cells This gene may function as a tumor suppressor in nasopharyngeal carcinoma Alternative splicing results in multiple transcript variants